PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma153g00160.1
Common NameZOSMA_153G00160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family HB-other
Protein Properties Length: 105aa    MW: 12494.5 Da    PI: 9.6775
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma153g00160.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.7e-092371752
                      HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox 17 elFeknrypsaeereeLAkklgLterqVkvWFqNrR 52
                      + F+++  p+ e+++eL+k+lg++ +qV  WF  r 
  Zosma153g00160.1  2 RIFKEDTDPDLEQKQELSKNLGMDIKQVNSWFYKRH 37
                      67******************************8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.576143IPR001356Homeobox domain
CDDcd000862.45E-4233No hitNo description
Gene3DG3DSA:1.10.10.605.1E-7234IPR009057Homeodomain-like
SuperFamilySSF466892.01E-7246IPR009057Homeodomain-like
PfamPF000462.3E-6237IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MRIFKEDTDP DLEQKQELSK NLGMDIKQVN SWFYKRHLQI KAKIMLLETS FLRNDNKRLR  60
DENELLWETI NKTVCKNCVD QLQGKIHRLQ SVICKIMDSK NKGW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PW292e-71A0A0K9PW29_Z
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.13e-15HD-ZIP family protein